Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 176B (Tmem176b)

This Recombinant Rat Transmembrane protein 176B (Tmem176b) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Transmembrane protein 176B, Protein LR8, Tolerance-related and induced transcript protein

UniProt

Q925D4

Expression Region

1-263

Origin

Rattus norvegicus (Rat)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQATVTVDGVKVTSTRPQSAQISIHIHHKSALEQLLGAMGSLKKFLSYPQARIHYGQLS LGVTQILLGLVSCVLGVCLYFGPWTELCASGCAFWSGSVAILAGVGIVIHEMGQGKLSGH ISRLLLLACSATAAAATVMGVKSLIWQTSASYYFEISSTCDSLQPSIVDRFRSVRFTDDS DWRTERCREYLRMMMNLFLAFCILFTVICILKIVVSVASLGLSLRSMCGRNSQVLNDEET EKKLLGGDSAPASPTKEKIPVTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BEND3 (NM_001080450) Human Recombinant Protein
TP315913M 100 µg

BEND3 (NM_001080450) Human Recombinant Protein

Sign In for Pricing
View Details
SHANK2 (NM_012309) Human Over-expression Lysate
LY432460 100 µg

SHANK2 (NM_012309) Human Over-expression Lysate

Sign In for Pricing
View Details
1,8-Diazabicyclo[5.4.0]undec-7-ene
TRC-D417090-150G 150 g

1,8-Diazabicyclo[5.4.0]undec-7-ene

Sign In for Pricing
View Details
Tnfrsf23 Mouse Gene Knockout Kit (CRISPR)
KN517987 1 Kit

Tnfrsf23 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS503146 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant ELOVL5 Antibody
RC-4313-01 50 μL

Recombinant ELOVL5 Antibody

Sign In for Pricing
View Details