Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dichelobacter nodosus ATP synthase subunit a (atpB)

This Recombinant Dichelobacter nodosus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5EXK1

Expression Region

1-263

Origin

Dichelobacter nodosus (strain VCS1703A)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATGGEMTSAEIIHHHMVNLTVGEGFWALHLDTLFFSILLGCSFCWLFYSIGKKAESGVP GFAQNVAEMVFDFIDNTVKGFFGESRSDIGSLALTLFCWIFFWNVMDLIPVDLLPSMAKL IGIPYLKIVPSTDPNATFALSISVVLITLVYTFRNNHGLLGMLRAMGTHPFESSGLIGKI LLFPANFALRIVEDMAKIVSLSLRLFGNLFAGEIVFILITFLPFWSQWVPGGAWAIFHIL VVTLQAYVFMILTIVYMSMVEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Binding Protein 5 (FABP5) Human Gene Knockout Kit (CRISPR)
KN401973 1 Kit

Fatty Acid Binding Protein 5 (FABP5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Stanniocalcin-1 Antibody
KC-27096-01 50 μL

Stanniocalcin-1 Antibody

Sign In for Pricing
View Details
Stanniocalcin-1 Antibody
KC-27096-02 100 µL

Stanniocalcin-1 Antibody

Sign In for Pricing
View Details
Stanniocalcin-1 Antibody
KC-27096-03 1 mL

Stanniocalcin-1 Antibody

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Rabbit Polyclonal Antibody
AP14396PU-N 400 µL

PDGF Receptor alpha (PDGFRA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LC3B (MAP1LC3B) Human Gene Knockout Kit (CRISPR)
KN207356LP 1 Kit

LC3B (MAP1LC3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details