Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dichelobacter nodosus ATP synthase subunit a (atpB)

This Recombinant Dichelobacter nodosus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5EXK1

Expression Region

1-263

Origin

Dichelobacter nodosus (strain VCS1703A)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATGGEMTSAEIIHHHMVNLTVGEGFWALHLDTLFFSILLGCSFCWLFYSIGKKAESGVP GFAQNVAEMVFDFIDNTVKGFFGESRSDIGSLALTLFCWIFFWNVMDLIPVDLLPSMAKL IGIPYLKIVPSTDPNATFALSISVVLITLVYTFRNNHGLLGMLRAMGTHPFESSGLIGKI LLFPANFALRIVEDMAKIVSLSLRLFGNLFAGEIVFILITFLPFWSQWVPGGAWAIFHIL VVTLQAYVFMILTIVYMSMVEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM5 Rabbit Polyclonal Antibody
AP20525PU-N 100 µg

RBM5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Chlorobromobenzene
TRC-C367085-10G 10 g

4-Chlorobromobenzene

Sign In for Pricing
View Details
TAS2R3 Human Gene Knockout Kit (CRISPR)
KN422347 1 Kit

TAS2R3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EIF2AK3 (601-1115) Rabbit Polyclonal Antibody
AP09082SU-N 100 µL

EIF2AK3 (601-1115) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Resveratrol 3,4’-Diacetate
TRC-R150130-5MG 5 mg

Resveratrol 3,4’-Diacetate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus,  40nm
GM-602-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Hepatitis B Virus, 40nm

Sign In for Pricing
View Details