Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dichelobacter nodosus ATP synthase subunit a (atpB)

This Recombinant Dichelobacter nodosus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5EXK1

Expression Region

1-263

Origin

Dichelobacter nodosus (strain VCS1703A)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATGGEMTSAEIIHHHMVNLTVGEGFWALHLDTLFFSILLGCSFCWLFYSIGKKAESGVP GFAQNVAEMVFDFIDNTVKGFFGESRSDIGSLALTLFCWIFFWNVMDLIPVDLLPSMAKL IGIPYLKIVPSTDPNATFALSISVVLITLVYTFRNNHGLLGMLRAMGTHPFESSGLIGKI LLFPANFALRIVEDMAKIVSLSLRLFGNLFAGEIVFILITFLPFWSQWVPGGAWAIFHIL VVTLQAYVFMILTIVYMSMVEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dicumyl Peroxide
TRC-D436013-5G 5 g

Dicumyl Peroxide

Sign In for Pricing
View Details
Alpha-Phenyl-Alpha-(2-pyridyl)acetonitrile-d4
TRC-P336652-5MG 5 mg

Alpha-Phenyl-Alpha-(2-pyridyl)acetonitrile-d4

Sign In for Pricing
View Details
EEFSEC Human Gene Knockout Kit (CRISPR)
KN420621 1 Kit

EEFSEC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dylight 649 Conjugated Phytolacca americana Lectin (Pokeweed) -PWM, PWA-
DY649-1901-1 1 mg

Dylight 649 Conjugated Phytolacca americana Lectin (Pokeweed) -PWM, PWA-

Sign In for Pricing
View Details
MYOM1 Antibody
8C16759-AAT 50 µg

MYOM1 Antibody

Sign In for Pricing
View Details
LINGO4 (C-term) Rabbit Polyclonal Antibody
AP52491PU-N 400 µL

LINGO4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details