Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina barkeri CoB--CoM heterodisulfide reductase subunit E (hdrE)

This Recombinant Methanosarcina barkeri CoB--CoM heterodisulfide reductase subunit E (hdrE) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

CoB--CoM heterodisulfide reductase subunit E, EC= 1.8.98.1

UniProt

P96796

Expression Region

1-263

Origin

Methanosarcina barkeri (strain Fusaro / DSM 804)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEEMLYFSGLSDVLRMTFVQIMIFSTIAIVIFLYGLISNFQKWGTGVTGYALEPQEGKK GSAITFLKTWWSQVTAESHHRGESILEILILDILFQRRILKRSPFRWVMHLFIFGGWMTL FALSGMMFAVEMTEKIGIALPFTPAEFRDFLSIPNYIFGYILLIGVLVALVRRLFVSEVR EASIMYDWVLIGIVFLVTISGFIADGIRTGFIWSFGLDPSVAPPAALFHSIFSLLFCIAF IPYSKYIHIIAIPLALLANKGGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-100 1x 100 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL
BNC680270-100 1x 100 µL

Fibronectin (HFN7.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-500 1x 500 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-100 1x 100 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details