Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Lysosomal-associated transmembrane protein 5 (LAPTM5)

This Recombinant Bovine Lysosomal-associated transmembrane protein 5 (LAPTM5) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

Lysosomal-associated transmembrane protein 5, Lysosomal-associated multitransmembrane protein 5

UniProt

Q2KJA5

Expression Region

1-264

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPRAAAIRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKFSKTGYLRI AELVSSFLLITMLFIISLSLLVGVVKNREKYLLPFLSLQIMDFLLCLLTLMGSYIELPAY LKFASRSSRRVSPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQDG MTHNQFIKIMIIFSIAFITVLILKVYMFKCVWRCYRLMKCTNSAEERSGSKMLQKVVLPS YEEAVSLPYKVPEGGPAPPPYSEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
BNC680525-500 1x 500 µL

CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details