Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptophysin-like protein 2 (Sypl2)

This Recombinant Mouse Synaptophysin-like protein 2 (Sypl2) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 2, Mitsugumin-29, Mg29

UniProt

O89104

Expression Region

1-264

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTESPGRTSDKSPRQQVDRLLLGLRWQRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GALVLCNNEAKDVSSIIVLFGYPFRLYQVQYEMPLCDQDSTSKTMNLMGDFSAPAEFFVT LGIFSFFYTMAALVIYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANLSVLFGFINFFLWAGNCWFVFKETPWH GQGQDQGQGPSQESAAEQGAVEKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-LIP5 antibody
SL4703R-01 50 µL

Rabbit Anti-LIP5 antibody

Sign In for Pricing
View Details
Rabbit Anti-LIP5 antibody
SL4703R-02 100 µL

Rabbit Anti-LIP5 antibody

Sign In for Pricing
View Details
anti-PRAK
YF-PA15697 100 ul

anti-PRAK

Sign In for Pricing
View Details
Abcg1-set siRNA/shRNA/RNAi Lentivector (Mouse)
11071094 4x 500 ng

Abcg1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Anti-Entamoeba histolytica Antibody
15020-1000-1 1 mg

Anti-Entamoeba histolytica Antibody

Sign In for Pricing
View Details
DDX4, CT (Probable ATP-dependent RNA Helicase DDX4, DEAD Box Protein 4, Vasa Homolog, VASA) (Biotin) discontinued
D1660-26A-Biotin 200 µL

DDX4, CT (Probable ATP-dependent RNA Helicase DDX4, DEAD Box Protein 4, Vasa Homolog, VASA) (Biotin) discontinued

Sign In for Pricing
View Details