Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptophysin-like protein 2 (Sypl2)

This Recombinant Mouse Synaptophysin-like protein 2 (Sypl2) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

Synaptophysin-like protein 2, Mitsugumin-29, Mg29

UniProt

O89104

Expression Region

1-264

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTESPGRTSDKSPRQQVDRLLLGLRWQRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET GALVLCNNEAKDVSSIIVLFGYPFRLYQVQYEMPLCDQDSTSKTMNLMGDFSAPAEFFVT LGIFSFFYTMAALVIYLRFHKLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANLSVLFGFINFFLWAGNCWFVFKETPWH GQGQDQGQGPSQESAAEQGAVEKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dusp12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4098108 1.0 µg DNA

Dusp12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Hsa-miR-454-3p miRNA Inhibitor
orb1873051-01 10 nmol

Hsa-miR-454-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-454-3p miRNA Inhibitor
orb1873051-02 20 nmol

Hsa-miR-454-3p miRNA Inhibitor

Sign In for Pricing
View Details
PAX3 (Paired Box 3, CDHS, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, WS1) (Biotin)
249755-Biotin 100 µL

PAX3 (Paired Box 3, CDHS, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778, WS1) (Biotin)

Sign In for Pricing
View Details
Recombinant Flavobacterium johnsoniae Pyridoxine 5'-phosphate synthase (pdxJ)
MBS1069763-01 0.02 mg (E-Coli)

Recombinant Flavobacterium johnsoniae Pyridoxine 5'-phosphate synthase (pdxJ)

Sign In for Pricing
View Details
Recombinant Flavobacterium johnsoniae Pyridoxine 5'-phosphate synthase (pdxJ)
MBS1069763-02 0.1 mg (E-Coli)

Recombinant Flavobacterium johnsoniae Pyridoxine 5'-phosphate synthase (pdxJ)

Sign In for Pricing
View Details