Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brevibacillus brevis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Brevibacillus brevis Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

C0ZIL1

Expression Region

1-265

Origin

Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQNIAIGQYVPGQSFLHRADPRSKLLFIILFATLIFLANNTVTYAILIGFTLYAALLSR LSLSYILKSLKPVWILILFTVVLHIFITKGGTVYFQWGWFTVEEQGVRQAIFISLRLGLL ILISSLLTLTTSPIDLTEGLERLLGPLGKIGIPVHDIALMMSIALRFIPTLMEETDKIIK AQTARGANFTSGSLVRRAKNLIPIAIPLFVSAFRRAEELALAMEARGYRGGVGRTRLNKL TFTWRDGIVAVVSVILVIVIGWWRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)
abx316660-01 20 µg

Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)
abx316660-02 50 µg

Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)
abx316660-03 100 µg

Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)
abx316660-04 200 µg

Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)

Sign In for Pricing
View Details
Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)
abx316660-05 1 mg

Guanine Nucleotide Exchange Factor VAV3 (VAV3) Antibody (HRP)

Sign In for Pricing
View Details
PSRC2 Double Nickase Plasmid (m)
sc-432080-NIC 20 µg

PSRC2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details