Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brevibacillus brevis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Brevibacillus brevis Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

C0ZIL1

Expression Region

1-265

Origin

Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQNIAIGQYVPGQSFLHRADPRSKLLFIILFATLIFLANNTVTYAILIGFTLYAALLSR LSLSYILKSLKPVWILILFTVVLHIFITKGGTVYFQWGWFTVEEQGVRQAIFISLRLGLL ILISSLLTLTTSPIDLTEGLERLLGPLGKIGIPVHDIALMMSIALRFIPTLMEETDKIIK AQTARGANFTSGSLVRRAKNLIPIAIPLFVSAFRRAEELALAMEARGYRGGVGRTRLNKL TFTWRDGIVAVVSVILVIVIGWWRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A3 Peptide
DF14099-BP 1 mg

SLC26A3 Peptide

Sign In for Pricing
View Details
Human ICOS Fc
MBS692519-01 0.01 mg

Human ICOS Fc

Sign In for Pricing
View Details
Human ICOS Fc
MBS692519-02 0.05 mg

Human ICOS Fc

Sign In for Pricing
View Details
Human ICOS Fc
MBS692519-03 5x 0.05 mg

Human ICOS Fc

Sign In for Pricing
View Details
BTC protein
30R-2744 20 ug

BTC protein

Sign In for Pricing
View Details
RPL21P86 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV777888 1.0 µg DNA

RPL21P86 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details