Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D9RZP4

Expression Region

1-265

Origin

Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREITIGQYIPGNSVIHRLDPRTKILITTAFMVLLFVIDDFTGYAFPAVFIIAVSILSGI SLKYMMRGLRPLVIIIVLTFVLNLFMIKGRVIYEIGPLDITYEGLYQGTFMVLRLIMLIV GTSLLTLTTSPIALTDGIESLLKPFRRVGVPAHELAMMMTIALRFIPTLMEETDKIMKAQ MARGADFASGNVVQRARSLVPLLVPLFINAFRRADDLAMAMESRCYRGGENRTRMKQLRM TSADLAAFIATGLLAVGSIMSRFIW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XFD594 Anti-human CD52 Antibody *HI186*
10520171-AAT 500 Tests

XFD594 Anti-human CD52 Antibody *HI186*

Sign In for Pricing
View Details
Human Alpha-1-Acid Glycoprotein 1 (ORM1) CLIA Kit
abx195067 96 Tests

Human Alpha-1-Acid Glycoprotein 1 (ORM1) CLIA Kit

Sign In for Pricing
View Details
ENMD-1068 HCl
BUP06863-01 10 mg

ENMD-1068 HCl

Sign In for Pricing
View Details
ENMD-1068 HCl
BUP06863-02 25 mg

ENMD-1068 HCl

Sign In for Pricing
View Details
ENMD-1068 HCl
BUP06863-03 50 mg

ENMD-1068 HCl

Sign In for Pricing
View Details
SAP18 Rabbit Polyclonal Antibody (Cy5.5)
orb1075586 100 µL

SAP18 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details