Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D9RZP4

Expression Region

1-265

Origin

Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREITIGQYIPGNSVIHRLDPRTKILITTAFMVLLFVIDDFTGYAFPAVFIIAVSILSGI SLKYMMRGLRPLVIIIVLTFVLNLFMIKGRVIYEIGPLDITYEGLYQGTFMVLRLIMLIV GTSLLTLTTSPIALTDGIESLLKPFRRVGVPAHELAMMMTIALRFIPTLMEETDKIMKAQ MARGADFASGNVVQRARSLVPLLVPLFINAFRRADDLAMAMESRCYRGGENRTRMKQLRM TSADLAAFIATGLLAVGSIMSRFIW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SREBP2/SREBF2 Antibody Picoband® Fluoro488 Conjugated
A01678-2-Fluoro488 100 µg/Vial

Anti-SREBP2/SREBF2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
TMEM38B Antibody - C-terminal region : HRP (ARP47395_P050-HRP)
ARP47395_P050-HRP 100 µL

TMEM38B Antibody - C-terminal region : HRP (ARP47395_P050-HRP)

Sign In for Pricing
View Details
FMNL1 Antibody
orb354951-01 50 µg

FMNL1 Antibody

Sign In for Pricing
View Details
FMNL1 Antibody
orb354951-02 100 µg

FMNL1 Antibody

Sign In for Pricing
View Details
Anti-Rad54 Like Protein 2 (RAD54L2)
FY-AB46480-01 1 mL

Anti-Rad54 Like Protein 2 (RAD54L2)

Sign In for Pricing
View Details
Anti-Rad54 Like Protein 2 (RAD54L2)
FY-AB46480-02 100 µL

Anti-Rad54 Like Protein 2 (RAD54L2)

Sign In for Pricing
View Details