Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Thermosediminibacter oceani Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D9RZP4

Expression Region

1-265

Origin

Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREITIGQYIPGNSVIHRLDPRTKILITTAFMVLLFVIDDFTGYAFPAVFIIAVSILSGI SLKYMMRGLRPLVIIIVLTFVLNLFMIKGRVIYEIGPLDITYEGLYQGTFMVLRLIMLIV GTSLLTLTTSPIALTDGIESLLKPFRRVGVPAHELAMMMTIALRFIPTLMEETDKIMKAQ MARGADFASGNVVQRARSLVPLLVPLFINAFRRADDLAMAMESRCYRGGENRTRMKQLRM TSADLAAFIATGLLAVGSIMSRFIW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Activating Transcription Factor 4 (ATF4), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027999 96 Tests

Multiplex Assay Kit for Activating Transcription Factor 4 (ATF4), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Anti-Theophylline Antibody
orb1148031-01 100 µg

Anti-Theophylline Antibody

Sign In for Pricing
View Details
Anti-Theophylline Antibody
orb1148031-02 500 µg

Anti-Theophylline Antibody

Sign In for Pricing
View Details
Anti-Theophylline Antibody
orb1148031-03 1 mg

Anti-Theophylline Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Multidrug resistance protein MdtC (mdtC), partial
MBS7089672 Inquire

Recombinant Escherichia coli O157:H7 Multidrug resistance protein MdtC (mdtC), partial

Sign In for Pricing
View Details
TSC1 siRNA (Human)
orb1863305-01 15 nmol

TSC1 siRNA (Human)

Sign In for Pricing
View Details