Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptoporin (Synpr)

This Recombinant Mouse Synaptoporin (Synpr) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Synaptoporin

UniProt

Q8BGN8

Expression Region

1-265

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCMVIFAPLFAMFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLQQVTFEVPT CEGKEQQKLALVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAVHSPVMSSLNTSV VFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGRYNQESYGSSGGYSQ QANLGPTSDEFGQQPSGPTSFNNQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL1RAPL1 Antibody (R3X06)
RHJ70001 100 μg

Anti-IL1RAPL1 Antibody (R3X06)

Sign In for Pricing
View Details
RBM22P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV742518 1.0 µg DNA

RBM22P11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Recombinant Rat Uteroglobin/SCGB1A1 Protein
NBP2-61370-1000ug 1000 µg

Recombinant Rat Uteroglobin/SCGB1A1 Protein

Sign In for Pricing
View Details
LUC7L3 Rabbit pAb
A18104 200 µL

LUC7L3 Rabbit pAb

Sign In for Pricing
View Details
RPS15AP15 3'UTR Lenti-reporter-Luc Vector
42112081 1.0 µg

RPS15AP15 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.)
AAF-444-1 1 mL

Alkaline Phosphatase Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.)

Sign In for Pricing
View Details