Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Synaptoporin (Synpr)

This Recombinant Mouse Synaptoporin (Synpr) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Synaptoporin

UniProt

Q8BGN8

Expression Region

1-265

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCMVIFAPLFAMFAFATCGGYSGGLRLSVDCVNKTESNLSIDIAFAYPFRLQQVTFEVPT CEGKEQQKLALVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV TVVFSFLWLVGSSAWAKGLSDVKVATDPKEVLLLMSACKQPSNKCMAVHSPVMSSLNTSV VFGFLNFILWAGNIWFVFKETGWHSSGQRYLSDPMEKHSSSYNQGRYNQESYGSSGGYSQ QANLGPTSDEFGQQPSGPTSFNNQI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)
TRV-0050843-01 20 µL

Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)

Sign In for Pricing
View Details
Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)
TRV-0050843-02 100 µL

Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)

Sign In for Pricing
View Details
Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)
TRV-0050843-03 200 µL

Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)

Sign In for Pricing
View Details
Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)
TRV-0050843-04 1 mL

Monoclonal Antibody to Phosphodiesterase 4B, cAMP Specific (PDE4B)

Sign In for Pricing
View Details
WWC3 Antibody - N-terminal region : Biotin (ARP72022_P050-Biotin)
ARP72022_P050-Biotin 100 µL

WWC3 Antibody - N-terminal region : Biotin (ARP72022_P050-Biotin)

Sign In for Pricing
View Details
TXNDC5 Antibody
E30AOC106 100 µL

TXNDC5 Antibody

Sign In for Pricing
View Details