Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Cobalamin synthase (cobS)

This Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Cobalamin synthase (cobS) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8EYK8

Expression Region

1-265

Origin

Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKLQEEWNRFCASWMFNTRLPILPFYVYSESTLSRSSRYFPLIGWIVSAGTSYSTYFLS WILPIEISIILGMILSVLITGGFHEDGLADVCDAFGGGWSKEKILEIMKDSRIGTFGSIG LILSLGLKYLLLVNLFKISPWIFLFTSWFSHSASRWFALLLMMLIPYARENDLSKSKPMI KKLPPFDFALSTFFGCFPAVYFLYQFQNQIPNVLLGFFLSSIFVFYFRNYFNKWIEGFTG DCLGFIQQGTELLFYLGITVSWNSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-100 1x 100 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P40 (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040375-100 1x 100 µL

P40 (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM452), CF594 conjugate, 0.1mg/mL
BNC940452-500 1x 500 µL

Vimentin (VM452), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), CF568 conjugate, 0.1mg/mL
BNC680892-100 1x 100 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details