Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Cobalamin synthase (cobS)

This Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Cobalamin synthase (cobS) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q8EYK8

Expression Region

1-265

Origin

Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKLQEEWNRFCASWMFNTRLPILPFYVYSESTLSRSSRYFPLIGWIVSAGTSYSTYFLS WILPIEISIILGMILSVLITGGFHEDGLADVCDAFGGGWSKEKILEIMKDSRIGTFGSIG LILSLGLKYLLLVNLFKISPWIFLFTSWFSHSASRWFALLLMMLIPYARENDLSKSKPMI KKLPPFDFALSTFFGCFPAVYFLYQFQNQIPNVLLGFFLSSIFVFYFRNYFNKWIEGFTG DCLGFIQQGTELLFYLGITVSWNSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome 20S alpha 2 Antibody, Cy5 Conjugated
bs-9351R-Cy5 100 µL

Proteasome 20S alpha 2 Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Lentiviral human CHIC2 shRNA (UAS) - Lentiviral human CHIC2 shRNA (UAS) (100)
GTR15153858 1 Vial

Lentiviral human CHIC2 shRNA (UAS) - Lentiviral human CHIC2 shRNA (UAS) (100)

Sign In for Pricing
View Details
CFAP300 (NM_032930) Human Tagged ORF Clone
RG202980 10 µg

CFAP300 (NM_032930) Human Tagged ORF Clone

Sign In for Pricing
View Details
RX-3117 50mg
A21259-50 50 mg

RX-3117 50mg

Sign In for Pricing
View Details
Bradykinin (1-3)
GWB-6026FD 5 mg

Bradykinin (1-3)

Sign In for Pricing
View Details
FAIM Protein Lysate (Rat) with C-HA Tag
19674036 100 µg

FAIM Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details