Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction beta-4 protein (Gjb4)

This Recombinant Rat Gap junction beta-4 protein (Gjb4) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Gap junction beta-4 protein, Connexin-30.3, Cx30.3

UniProt

P36380

Expression Region

1-265

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWGFLQGILSGVNKYSTALGRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFICNTKQPGC PNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHRLKHGPDAPALYSNL SKKRGGLWWTYLLSLIFKAAVDSGFLYIFHCIYKDYDMPRVVACSVQPCPHTVDCYISRP TEKKVFTYFMVVTAAICILLNLSEVAYLVGKRCMEVFRPRRQKTSRRHQLPDTCPPYVIS KGHPQDESTVLTKAGMATVDAGVYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A HMBA
HA25031514.25G 25 g

Polystyrene A HMBA

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), Biotin conjugate, 0.1mg/mL
BNCB1576-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (Epithelial Marker) (KRTH/1576R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Over-expression Lysate
LC401202 20 µg

PI 3 Kinase p55 gamma (PIK3R3) (NM_003629) Human Over-expression Lysate

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3226), CF405S conjugate, 0.1mg/mL
BNC043226-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CITED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]
TA807048AM 100 µL

CITED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E11]

Sign In for Pricing
View Details
Golgi Complex (AE-6), CF594 conjugate, 0.1mg/mL
BNC940868-500 1x 500 µL

Golgi Complex (AE-6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details