Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium acetobutylicum Probable sporulation sigma-E factor-processing peptidase (spoIIGA)

This Recombinant Clostridium acetobutylicum Probable sporulation sigma-E factor-processing peptidase (spoIIGA) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Probable sporulation sigma-E factor-processing peptidase, EC= 3.4.23.-, Stage II sporulation protein GA

UniProt

Q45832

Expression Region

1-266

Origin

Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVIYLDVLIFENSIVNTFLLYITAQTLRIKVKMRYLILAGIFGGLYVIVLVIPTLKIFSS LIFKIIAAFLMIIICFRKKSLRFNIKALAVLIMYSMVTAGLCFFIELNNTRGSYFNAFIG NVSYKWILIAIMIIYMFVNRIIWFINDRKLTQSLIYEIEICFKDNSKFINAFLDTGNELR EPITNLPVIVVEKDMVSGIKWDDCPKFYVPFRLFNGKAGNLEAFKPSYVKIYIGDKVEVR NAIIALIDNKLSSLNDYNALLSRGSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM117A Rabbit Polyclonal Antibody
TA376090 100 µL

FAM117A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDADC1 (NM_001193478) Human Over-expression Lysate
LC434270 20 µg

CDADC1 (NM_001193478) Human Over-expression Lysate

Sign In for Pricing
View Details
2,6-Dichloro-1,4-phenylenediamine
TRC-D437970-100MG 100 mg

2,6-Dichloro-1,4-phenylenediamine

Sign In for Pricing
View Details
Firefly & Renilla Luciferase Single Tube Assay Kit, 50 Assays
#30081-T 1 Kit

Firefly & Renilla Luciferase Single Tube Assay Kit, 50 Assays

Sign In for Pricing
View Details
LRRN5 (LRRN2) (NM_201630) Human Over-expression Lysate
LC404491 20 µg

LRRN5 (LRRN2) (NM_201630) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS503179 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details