Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Derlin-1 (DER1)

This Recombinant Arabidopsis thaliana Derlin-1 (DER1) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Derlin-1, AtDerlin1-1

UniProt

Q8VZU9

Expression Region

1-266

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSPGEFYNSLPPITKAYGTLCFFTTVATQLGLVAPVHIALIPELVLKQFQIWRLITNLF FLGGFSINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFL GVSLVFMLLYLWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGH LYYFLTVLHPLATGKNYLKTPKWVNKIVARWRIGAPVASVRQAGGVGAAGPGAGGGVGGG GAYSSARAPPESSNTAFRGRSYRLTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL
BNC740276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL
BNC470029-500 1x 500 µL

Fibronectin (TV-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-100 1x 100 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF647 conjugate, 0.1mg/mL
BNC471099-100 1x 100 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF740 conjugate, 0.1mg/mL
BNC741167-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details