Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-4 protein (GJB4)

This Recombinant Human Gap junction beta-4 protein (GJB4) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Gap junction beta-4 protein, Connexin-30.3, Cx30.3

UniProt

Q9NTQ9

Expression Region

1-266

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWAFLQGLLSGVNKYSTVLSRIWLSVVFIFRVLVYVVAAEEVWDDEQKDFVCNTKQPGC PNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNL SKKRGGLWWTYLLSLIFKAAVDAGFLYIFHRLYKDYDMPRVVACSVEPCPHTVDCYISRP TEKKVFTYFMVTTAAICILLNLSEVFYLVGKRCMEIFGPRHRRPRCRECLPDTCPPYVLS QGGHPEDGNSVLMKAGSAPVDAGGYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloroacridin-9(10H)-one
TRC-C363765-50MG 50 mg

2-Chloroacridin-9(10H)-one

Sign In for Pricing
View Details
Human TC2N activation kit by CRISPRa
GA114797 1 Kit

Human TC2N activation kit by CRISPRa

Sign In for Pricing
View Details
Prss39 Mouse Gene Knockout Kit (CRISPR)
KN514040 1 Kit

Prss39 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody
HA723944 100 µL

Mouse Apolipoprotein B/Apo B Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GABPB2 (GABPB1) (NM_002041) Human Over-expression Lysate
LC419570 20 µg

GABPB2 (GABPB1) (NM_002041) Human Over-expression Lysate

Sign In for Pricing
View Details
GPR177 (WLS) Rabbit Polyclonal Antibody
TA372679 100 µL

GPR177 (WLS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details