Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum ATP synthase subunit a (atpB)

This Recombinant Pectobacterium carotovorum subsp. carotovorum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C6DJG6

Expression Region

1-266

Origin

Pectobacterium carotovorum subsp. carotovorum (strain PC1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGEISTPQEYISHHLHHLQVGTGFWSINVDSMFFSIALGILFLVIFHRVAKRATSGVP GKLQTAVELIIGFVDGTVRDMFHGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPQAWAG IYSLLGYDPAHAYLRAVPTADVNITLSMALGVFILVLFYSIKMKGLGGFVKELTMQPFNH PVFIPINLILEGVSLLSKPISLGLRLFGNMYAGELIFILIAGLLPWWSQWLLNVPWAIFH ILIITLQAFIFMVLTVVYLSMASEEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-100 1x 100 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-500 1x 500 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF740 conjugate, 0.1mg/mL
BNC740183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF647 conjugate, 0.1mg/mL
BNC470487-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details