Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus fermentum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Lactobacillus fermentum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D8IIP4

Expression Region

1-267

Origin

Lactobacillus fermentum (strain CECT 5716)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSRVLFGSFVPVDSVLHRLDPRLKLVTCFWYVVIIFFAKGPLTYLLLVAMLGAMIGLSK VPLKMYWAGLKPLLWVIGLTIAIQVLFSSGGHVYWHWGLMAITSGGINQALVILARFILI VLASTVLTATTPPLRLADAIESLMKPLKKIKVPVNQIAMMISIALRFIPTIMDEVNTIVK AQQARGVDFTSGSVYTRVKRMVPIMVPLFVGAFRRAEDLAVAMEARGYDPDQERTRYRQL TWRRPDSIALAVVVIVSVLFFVARILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)
MBS2107281-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)
MBS2107281-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)
MBS2107281-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)
MBS2107281-04 1 mL

Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)
MBS2107281-05 5 mL

Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)
MBS2107281-06 5x 5 mL

Cy3-Linked Monoclonal Antibody to Immunoglobulin M (IgM)

Sign In for Pricing
View Details