Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus fermentum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Lactobacillus fermentum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D8IIP4

Expression Region

1-267

Origin

Lactobacillus fermentum (strain CECT 5716)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSRVLFGSFVPVDSVLHRLDPRLKLVTCFWYVVIIFFAKGPLTYLLLVAMLGAMIGLSK VPLKMYWAGLKPLLWVIGLTIAIQVLFSSGGHVYWHWGLMAITSGGINQALVILARFILI VLASTVLTATTPPLRLADAIESLMKPLKKIKVPVNQIAMMISIALRFIPTIMDEVNTIVK AQQARGVDFTSGSVYTRVKRMVPIMVPLFVGAFRRAEDLAVAMEARGYDPDQERTRYRQL TWRRPDSIALAVVVIVSVLFFVARILL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Whatman GFA 55mm Membrane Glass Microfibre
FIL4116 100 / Box

Whatman GFA 55mm Membrane Glass Microfibre

Sign In for Pricing
View Details
Cyclooxygenase 2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0732R-BF680 100 µL

Cyclooxygenase 2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
LentimiRa-Off-hsa-miR-3618 Vector
mh30592 500 ng

LentimiRa-Off-hsa-miR-3618 Vector

Sign In for Pricing
View Details
Fam176a ORF Vector (Mouse) (pORF)
19845014 1.0 µg DNA

Fam176a ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PBXIP1 Antibody, FITC conjugated
CSB-PA856896HC01HU-01 50 µg

PBXIP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
PBXIP1 Antibody, FITC conjugated
CSB-PA856896HC01HU-02 100 µg

PBXIP1 Antibody, FITC conjugated

Sign In for Pricing
View Details