Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leuconostoc mesenteroides subsp. mesenteroides Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Leuconostoc mesenteroides subsp. mesenteroides Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

Q03ZL4

Expression Region

1-267

Origin

Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNIMIGRFVPGDSWIHRLDPRTKMIGTFIFIFVMLWSTSWATYAWSAAFVVLAIRLTKQ PFRLYWDGLKPIFWLILFTVVLQLFFTPGTPVLLHAGPLKVTIPGIINAIYVMIRFVLII LMSTILTLTTPPTSIANALESLLKPLKKIHVPVAELSLMLSIALRFVPLLMDETQKIMNA QKSRGMSFSTGGPIKRAKAIVPLLIPLFVGALQRALDLANAMEVRGFQDATQRTKYRVLS YGSNDRSAFIGLIGFTIIFIGINFFIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL
BNC470158-100 1x 100 µL

Cytokeratin 17 (E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF568 conjugate, 0.1mg/mL
BNC680967-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details