Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Staphylococcus aureus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D3ERJ1

Expression Region

1-268

Origin

Staphylococcus aureus (strain 04-02981)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKLIIGRYLPINSFVHHLDPRAKLMFVFLFIILIFFCHSPLTYLWVFALILFIMRLAK IQLWFLIKGLTPIFFFLIFTLMMHIFLTKGGYVLVEWHGITIETNGILEGLYISLRLIGI VMIATIMTLSTSPIDLTDAFERLLAPLKMFKLPVHQLSMIMSIALRFIPTLMDELDKIIL AQKSRGSEISSGNIATRIKSFIPLLVPLFISAFQRAEELAVAMEVRGYDANVKRTSYRQL KWQLRDTISLTMIIPIAIILFVLKYSGV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM71F1 Antibody (Biotin)
orb36136-01 50 µg

FAM71F1 Antibody (Biotin)

Sign In for Pricing
View Details
FAM71F1 Antibody (Biotin)
orb36136-02 100 µg

FAM71F1 Antibody (Biotin)

Sign In for Pricing
View Details
E2F6 (NM_198256) Human Tagged ORF Clone
RC210680 10 µg

E2F6 (NM_198256) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBR027C Polyclonal Antibody
MBS7157368 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) YBR027C Polyclonal Antibody

Sign In for Pricing
View Details
ALDH6A1 AAV Vector (Human) (CMV)
11739101 1 µg

ALDH6A1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MreB Perturbing Compound A22 (hydrochloride)
HY-118773-01 5 mg

MreB Perturbing Compound A22 (hydrochloride)

Sign In for Pricing
View Details