Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Staphylococcus aureus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D3ERJ1

Expression Region

1-268

Origin

Staphylococcus aureus (strain 04-02981)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKLIIGRYLPINSFVHHLDPRAKLMFVFLFIILIFFCHSPLTYLWVFALILFIMRLAK IQLWFLIKGLTPIFFFLIFTLMMHIFLTKGGYVLVEWHGITIETNGILEGLYISLRLIGI VMIATIMTLSTSPIDLTDAFERLLAPLKMFKLPVHQLSMIMSIALRFIPTLMDELDKIIL AQKSRGSEISSGNIATRIKSFIPLLVPLFISAFQRAEELAVAMEVRGYDANVKRTSYRQL KWQLRDTISLTMIIPIAIILFVLKYSGV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-PCLKC antibody
SL13729R-01 50 µL

Rabbit Anti-PCLKC antibody

Sign In for Pricing
View Details
Rabbit Anti-PCLKC antibody
SL13729R-02 100 µL

Rabbit Anti-PCLKC antibody

Sign In for Pricing
View Details
Mouse Monoclonal VEGF Antibody (VG1)
NB100-664 0.1 mg

Mouse Monoclonal VEGF Antibody (VG1)

Sign In for Pricing
View Details
Dpp8 (NM_001108159) Rat Tagged ORF Clone Lentiviral Particle
RR210169L3V 200 µL

Dpp8 (NM_001108159) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
F-Box And WD Repeat Domain Containing 4 (FBXW4) Antibody
abx322289-01 20 µL

F-Box And WD Repeat Domain Containing 4 (FBXW4) Antibody

Sign In for Pricing
View Details
F-Box And WD Repeat Domain Containing 4 (FBXW4) Antibody
abx322289-02 50 µL

F-Box And WD Repeat Domain Containing 4 (FBXW4) Antibody

Sign In for Pricing
View Details