Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Staphylococcus aureus Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D3ERJ1

Expression Region

1-268

Origin

Staphylococcus aureus (strain 04-02981)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKLIIGRYLPINSFVHHLDPRAKLMFVFLFIILIFFCHSPLTYLWVFALILFIMRLAK IQLWFLIKGLTPIFFFLIFTLMMHIFLTKGGYVLVEWHGITIETNGILEGLYISLRLIGI VMIATIMTLSTSPIDLTDAFERLLAPLKMFKLPVHQLSMIMSIALRFIPTLMDELDKIIL AQKSRGSEISSGNIATRIKSFIPLLVPLFISAFQRAEELAVAMEVRGYDANVKRTSYRQL KWQLRDTISLTMIIPIAIILFVLKYSGV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku70 (G-7)
sc-55505 200 µg/mL

Ku70 (G-7)

Sign In for Pricing
View Details
CA12 (Carbonic Anhydrase 12) BioAssayTM ELISA Kit (Human) discontinued
354422-01 48 Tests

CA12 (Carbonic Anhydrase 12) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
CA12 (Carbonic Anhydrase 12) BioAssayTM ELISA Kit (Human) discontinued
354422-02 96 Tests

CA12 (Carbonic Anhydrase 12) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Bovine Leucine-rich repeat neuronal protein 1, LRRN1 ELISA Kit
MBS9325988-01 48 Well

Bovine Leucine-rich repeat neuronal protein 1, LRRN1 ELISA Kit

Sign In for Pricing
View Details
Bovine Leucine-rich repeat neuronal protein 1, LRRN1 ELISA Kit
MBS9325988-02 96 Well

Bovine Leucine-rich repeat neuronal protein 1, LRRN1 ELISA Kit

Sign In for Pricing
View Details
Bovine Leucine-rich repeat neuronal protein 1, LRRN1 ELISA Kit
MBS9325988-03 5x 96 Well

Bovine Leucine-rich repeat neuronal protein 1, LRRN1 ELISA Kit

Sign In for Pricing
View Details