Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus selenitireducens Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Bacillus selenitireducens Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

D6XVS2

Expression Region

1-268

Origin

Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDSIIIGQYVPGDSVVHRLDPRVKLTAVFIFLVFMFMTRDPLLLTVAVLLSFGGLLASR VPLSFYAKGMRFISIIIVLTFVLHLFMTGGGEVIVELPFATIYSGGLIEGFMLAMKLAMI ITIASLLTLTTTPIDLTDGMERMLAPFKRVKLPTHELALMMSIALRFIPTLIEETRTIVL AQLARGTNFSEGSLWKRLKALIPILVPLFTQSFKRAEELATAMEARGYAGGEGRTKYRQL HWGLKDSVVLAVFLLFAAAVMAERFMGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WNK2 activation kit by CRISPRa
GA112260 1 Kit

Human WNK2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human control serum (non-immunized), Adult, mixed sexes
NHUS-5 5 mL

Human control serum (non-immunized), Adult, mixed sexes

Sign In for Pricing
View Details
DHX32 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-6944R-BF350 100 µL

DHX32 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
ABCB1 Human Pre-designed siRNA Set A
HY-RS00048 1 Set

ABCB1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
HKR1 (h) -PR
sc-97871-PR 10 µM - 20 µL

HKR1 (h) -PR

Sign In for Pricing
View Details
SNTG2 CRISPR Knock Out 293T Cell Line (Human)
45013141 1x 10^6 Cells / 1.0 mL

SNTG2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details