Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1089 (MJ1089)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1089 (MJ1089) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1089

UniProt

Q58489

Expression Region

1-268

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFMKHNIVDNVAFSNKLRHVNPKLKVIFALSLLLISVFSTSFIVPLIIFFINSILLLFK AKVPKKIYAVFVGIPLGFGILNLVIFAFLFGTVEWFKINVFGFEIPVYKDGIELGLLLFG RMLGGVSSMLFLAFTTPMVELFYIFRELKMPDVLVDMMMLIYRYIFVLYEEYEKMKFAQE SRLGTSNLKSTYKSLGALAAHLFIRAWEKGEKLNITMMSRCYDGKIKLLQTIENPSIKYI LFIAIFDIFLIILAYLTKDFTLTSYIKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Analytical Balance BBAL-112
BBAL-112 1 Unit

Analytical Balance BBAL-112

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF740 conjugate, 0.1mg/mL
BNC742040-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF740 conjugate, 0.1mg/mL
BNC743294-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3294), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (LN-2 + CLIP/813), 0.2mg/mL
BNUB1207-100 1x 100 µL

CD74 (LN-2 + CLIP/813), 0.2mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF405S conjugate, 0.1mg/mL
BNC041670-100 1x 100 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF568 conjugate, 0.1mg/mL
BNC682210-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details