Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-5 (TSPAN5)

This Recombinant Human Tetraspanin-5 (TSPAN5) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Tetraspanin-5, Tspan-5, Tetraspan NET-4, Transmembrane 4 superfamily member 9

UniProt

P62079

Expression Region

1-268

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFD PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF IGIALLQIFGICLAQNLVSDIEAVRASW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kdm1b shRNA (UAS) - Lentiviral mouse Kdm1b shRNA (UAS) plasmid
GTR15103039 1 Vial

Lentiviral mouse Kdm1b shRNA (UAS) - Lentiviral mouse Kdm1b shRNA (UAS) plasmid

Sign In for Pricing
View Details
AASDHPPT Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-11390R-BF750 100 µL

AASDHPPT Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Caspase-2/CASP2 Rabbit Polyclonal Antibody (PE)
orb2622066 100 µg

Caspase-2/CASP2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Cyclin D3/CCND3 Mouse mAb
orb2716990-01 50 µL

Cyclin D3/CCND3 Mouse mAb

Sign In for Pricing
View Details
Cyclin D3/CCND3 Mouse mAb
orb2716990-02 100 µL

Cyclin D3/CCND3 Mouse mAb

Sign In for Pricing
View Details
Glycidyl Myristate
TRC-G615800-500MG 500 mg

Glycidyl Myristate

Sign In for Pricing
View Details