Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Streptococcus equi subsp. equi Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

C0MBF3

Expression Region

1-269

Origin

Streptococcus equi subsp. equi (strain 4047)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKLILGRYIPGNSIIHRLDPRSKLLAMIIYIIIIFWANNVVTNLLLLAFTLLLIFLSQI KWSFFFNGVKPMIGIILFTTLFQVFFTQGGSVLFQLGIIKITSLGLSQAILIFMRFVLII FFSTLLTLTTTPLSLSDAVEALLKPLVRFKVPAHEIGLMLSLSLRFVPTLMDDTTRIMNA QKARGVDFGEGNLIQKVKSIIPILIPLFASSFKRADALAIAMEARGYQGGDSRTKYRLLS WQLKDTLAIILVVILGIFLFCLKSPSRLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trub1 Mouse shRNA Lentiviral Particle (Locus ID 72133)
TL513226V 500 µL Each

Trub1 Mouse shRNA Lentiviral Particle (Locus ID 72133)

Sign In for Pricing
View Details
Vom1r104 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6284908 1.0 µg DNA

Vom1r104 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Inmt sgRNA CRISPR Lentivector (Rat) (Target 3)
K6046104 1.0 µg DNA

Inmt sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
1-Bromo-3-methoxy-cyclobutane
JH915916 1 Each

1-Bromo-3-methoxy-cyclobutane

Sign In for Pricing
View Details
Estrogen Receptor, phosphorylated (Ser118) (ER) discontinued
E3565-03 200 µL

Estrogen Receptor, phosphorylated (Ser118) (ER) discontinued

Sign In for Pricing
View Details
UBE2R2 Polyclonal Antibody
MBS2537103-01 0.06 mL

UBE2R2 Polyclonal Antibody

Sign In for Pricing
View Details