Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein T02E1.7 (T02E1.7)

This Recombinant Uncharacterized protein T02E1.7 (T02E1.7) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Uncharacterized protein T02E1.7

UniProt

O45731

Expression Region

1-269

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDINVVITRCEDYTETLARNTRKVLPTIGRLLLISTFVEDGLRLLFNTHDHVNHFSYNWG LNYHFSLFLTIVMIINLLFGSLFVMMRYKVTESSAVLGFTIFAQVILYQLYTTYHLLTRN ISIVAAIMLLVAENMLRKPKPANYTQLPRDEHEIEVTSVLLAACRVCLNLMLISMVHFDM SYTRILLCIISYGMMIFVWLGFKTRMMSFMLATWLFAYNIVLNDFWNKDAELHIIRYDFF QTLSAIGGLLLLIHTGPGEFSFDELKKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r36 Mouse Gene Knockout Kit (CRISPR)
KN519048 1 Kit

Vmn1r36 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHRNA1 Rabbit Polyclonal Antibody
ER1902-58 100 µL

CHRNA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF640R conjugate, 0.1mg/mL
BNC403185-100 1x 100 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cd44 Rat Monoclonal Antibody [Clone ID: KM81]
CL023P 250 µg

Cd44 Rat Monoclonal Antibody [Clone ID: KM81]

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Deoxy-3,4:5,6-di-O-isopropylidene-D-arabino-hexose Propylene Dithioacetal
TRC-D232805-5MG 5 mg

2-Deoxy-3,4:5,6-di-O-isopropylidene-D-arabino-hexose Propylene Dithioacetal

Sign In for Pricing
View Details