Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Surfeit locus protein 4 (Surf4)

This Recombinant Mouse Surfeit locus protein 4 (Surf4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

Q64310

Expression Region

1-269

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWS CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCAR2 Knockout KYSE150 Polyclonal Cells
ARG36231 1 Million

HCAR2 Knockout KYSE150 Polyclonal Cells

Sign In for Pricing
View Details
ASAP2 Antibody
MBS8518452-01 0.05 mg

ASAP2 Antibody

Sign In for Pricing
View Details
ASAP2 Antibody
MBS8518452-02 0.1 mg

ASAP2 Antibody

Sign In for Pricing
View Details
ASAP2 Antibody
MBS8518452-03 0.1 mL (AF750)

ASAP2 Antibody

Sign In for Pricing
View Details
ASAP2 Antibody
MBS8518452-04 0.1 mL (AF405M)

ASAP2 Antibody

Sign In for Pricing
View Details
ASAP2 Antibody
MBS8518452-05 0.1 mL (AF546)

ASAP2 Antibody

Sign In for Pricing
View Details