Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Surfeit locus protein 4 (Surf4)

This Recombinant Mouse Surfeit locus protein 4 (Surf4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

Q64310

Expression Region

1-269

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWS CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD100/SEMA4D Antibody (SAA0332), FITC
MBS1586025-01 50 Tests

Anti-Mouse CD100/SEMA4D Antibody (SAA0332), FITC

Sign In for Pricing
View Details
Anti-Mouse CD100/SEMA4D Antibody (SAA0332), FITC
MBS1586025-02 100 Tests

Anti-Mouse CD100/SEMA4D Antibody (SAA0332), FITC

Sign In for Pricing
View Details
Anti-Mouse CD100/SEMA4D Antibody (SAA0332), FITC
MBS1586025-03 5x 100 Tests

Anti-Mouse CD100/SEMA4D Antibody (SAA0332), FITC

Sign In for Pricing
View Details
GPRC6A Polyclonal Conjugated Antibody
C31590 100 µL

GPRC6A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Myripristis violacea Rhodopsin (rho)
MBS1133148 Inquire

Recombinant Myripristis violacea Rhodopsin (rho)

Sign In for Pricing
View Details
Proteasome 19S Rpt5/S6a subunit polyclonal antibody
MBS566521-01 0.025 mL

Proteasome 19S Rpt5/S6a subunit polyclonal antibody

Sign In for Pricing
View Details