Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Surfeit locus protein 4 (Surf4)

This Recombinant Mouse Surfeit locus protein 4 (Surf4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

Q64310

Expression Region

1-269

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWS CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cIAP1 Ligand-Linker Conjugates 9
MBS5770766 Inquire

cIAP1 Ligand-Linker Conjugates 9

Sign In for Pricing
View Details
NAB2 Protein Vector (Human) (pPM-C-His)
PV027480 500 ng

NAB2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal 14-3-3 beta Antibody (03) [FITC]
NBP3-06516F 0.1 mL

Mouse Monoclonal 14-3-3 beta Antibody (03) [FITC]

Sign In for Pricing
View Details
CCDC83 (Coiled-coil Domain-Containing Protein 83, CCDC83) (Biotin) discontinued
302328-Biotin 200 µL

CCDC83 (Coiled-coil Domain-Containing Protein 83, CCDC83) (Biotin) discontinued

Sign In for Pricing
View Details
Phospho-PRKCQ (Ser695) Polyclonal Antibody, PerCP Conjugated
bs-5584R-PerCP 100 µL

Phospho-PRKCQ (Ser695) Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Rat Protein phosphatase 1 regulatory subunit 1A ELISA Kit
MBS7276018-01 48 Well

Rat Protein phosphatase 1 regulatory subunit 1A ELISA Kit

Sign In for Pricing
View Details