Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Surfeit locus protein 4 (SURF4)

This Recombinant Pongo abelii Surfeit locus protein 4 (SURF4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

Q5R705

Expression Region

1-269

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWN CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEIS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G8]
TA809618AM 100 µL

MEIS1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G8]

Sign In for Pricing
View Details
Tnnc2 (NM_009394) Mouse Tagged ORF Clone
MG201248 10 µg

Tnnc2 (NM_009394) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Ghrh activation kit by CRISPRa
GA201606 1 Kit

Mouse Ghrh activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Cnn2 activation kit by CRISPRa
GA200791 1 Kit

Mouse Cnn2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), Biotin conjugate, 0.1mg/mL
BNCB0266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR51B4 Human Gene Knockout Kit (CRISPR)
KN420018 1 Kit

OR51B4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details