Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Surfeit locus protein 4 (SURF4)

This Recombinant Pongo abelii Surfeit locus protein 4 (SURF4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

Q5R705

Expression Region

1-269

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWN CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLNC Polyclonal Antibody
E-AB-19875-01 20 µL

FLNC Polyclonal Antibody

Sign In for Pricing
View Details
FLNC Polyclonal Antibody
E-AB-19875-02 60 µL

FLNC Polyclonal Antibody

Sign In for Pricing
View Details
FLNC Polyclonal Antibody
E-AB-19875-03 120 µL

FLNC Polyclonal Antibody

Sign In for Pricing
View Details
FLNC Polyclonal Antibody
E-AB-19875-04 200 µL

FLNC Polyclonal Antibody

Sign In for Pricing
View Details
Aurora B (AURKB) Rabbit Polyclonal Antibody
AP06627PU-N 100 µg

Aurora B (AURKB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Muscarinic Acetylcholine Receptor M3 (CHRM3) Rabbit Polyclonal Antibody
TA374769 100 µL

Muscarinic Acetylcholine Receptor M3 (CHRM3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details