Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Gap junction gamma-3 protein (Gjc3)

This Recombinant Mouse Gap junction gamma-3 protein (Gjc3) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Gap junction gamma-3 protein, Connexin-29, Cx29, Gap junction epsilon-1 protein

UniProt

Q921C1

Expression Region

1-269

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLLELPIKCRMCGRFLRQLLAQESQHSTPVGRFLLPMLMGFRLLILVSSGPGVFGNDEN EFICHLGQPGCKTICYDVFRPLSPLRFWAFQVILMAVPSAIYVAFTLYHVIGYWEVPGKE NKEQETQISKGDHSKDVSGAKSLKLLWAYVAHLGVRLALEGAALGVQYNLYGFKMSSTFI CREDPCIGSTTCFQSHPSEKTIFLNIMFGISGACFLFIFLELALLGLGRFWRIYKHKLSF LKKLPTSESSVRSKDTTDELSVVEAKEPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF594 conjugate, 0.1mg/mL
BNC942713-500 1x 500 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-100 1x 100 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (HH1/1784R), CF640R conjugate, 0.1mg/mL
BNC401784-500 1x 500 µL

Histone H1 (Nuclear Marker) (HH1/1784R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details