Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Surfeit locus protein 4 (SURF4)

This Recombinant Human Surfeit locus protein 4 (SURF4) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Surfeit locus protein 4

UniProt

O15260

Expression Region

1-269

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWN CGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFF SIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFF QTMSVIGGLLLVVALGPGGVSMDEKKKEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCA7 CRISPRa sgRNA lentivector (set of three targets)(Rat)
11022126 3x 1.0µg DNA

ABCA7 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Orange Oil Extrapure
1894A 00500 500 mL

Orange Oil Extrapure

Sign In for Pricing
View Details
ZFP64 (Zinc Finger Protein 64 Homolog, isoforms 1 and 2, Zfp-64, Zinc Finger Protein 338, ZFP64, ZNF338) (MaxLight 405) discontinued
302859-ML405 100 µL

ZFP64 (Zinc Finger Protein 64 Homolog, isoforms 1 and 2, Zfp-64, Zinc Finger Protein 338, ZFP64, ZNF338) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Custom siRNA duplex Reverse Phase Purified; 100 nmols
27-6437-01 100 nmols

Custom siRNA duplex Reverse Phase Purified; 100 nmols

Sign In for Pricing
View Details
ERCC1 Mouse Monoclonal Antibody
MBS8501560-01 0.1 mg

ERCC1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ERCC1 Mouse Monoclonal Antibody
MBS8501560-02 0.1 mL (AF635)

ERCC1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details