Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Prespore protein Dd31 (spiA)

This Recombinant Dictyostelium discoideum Prespore protein Dd31 (spiA) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Prespore protein Dd31

UniProt

Q02465

Expression Region

1-269

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHNNNPGTPQMSSEFPASTTQTSSSAAAYDNSSHFEKEQSLMRWEQDLKLRERALANNQ SAADITGPHVVVPAPATAHPRQANFPSSYPMIRLNLEEDIAIREYRQIVKFGIFVFLWEA AALVYNWVVSIGTIVYSAVDNFFLALFYMIVGVPTLYFLTRKLYRAASVPERARKSYAYL MALLGVVLFNIIFFVGFKRSGMNGLIWVISLFHNDHNAVGAMATVSLFFWFVGVFLTIAL FIMYLRLNNTKRQRGEIQNAGFREYIKSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-500 1x 500 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-500 1x 500 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details