Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium kluyveri Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Clostridium kluyveri Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

A5N4S9

Expression Region

1-270

Origin

Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKDITIGQYVPGDSFIHKLDPRVKILISLIYIVDLFIVNSFKGYIFIVVFTLISILVSK VQFTYIYKGLKPIFILVLITAVLNIFMTGGANPPLFKWKFLVVYREGLIMAAFMALRLVF LIIGTSLLTLTTSPIELTDGIEKLLKPVSKIGVPSHELAMMMTIALRFIPTLMDETDKIM KAQIARGADLESGNLIQKAKNLVPILVPLFISSFRRADELAMAMEARCYRGGDGRTRMKE LKLSNRDFIASLCALVLVCISILSRIWWGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF568 conjugate, 0.1mg/mL
BNC681775-500 1x 500 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL
BNC942366-100 1x 100 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9/781), CF405S conjugate, 0.1mg/mL
BNC040781-500 1x 500 µL

Carbonic Anhydrase IX (CA9/781), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF594 conjugate, 0.1mg/mL
BNC941932-100 1x 100 µL

CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details