Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Membrane protein insertase YidC (yidC)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 20-289.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

Q49Z38

Expression Region

20-289

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CDYSKPENRDGFFYNTFYVPMDNVIHWLGTSFNNDYGLAIVVLVLVIRIVLLPFMLSNYK NSHMMREKMKVAKPDIDAIQEKVKRSRTQEEKMAANSEMMEVYKKYDMNPMKSMLGCLPI LIQMPIIMGLFFVLKYPSSGGFTEHPYFLWFNLAKPDIWITIIAGILYFLQAYVSSKSMP AEQRQMGYMMMVISPIMIVWISFSSVSALGLYWSVSAAFLIVQTQVANMYYSKLAQREVA PMIEAMEKNKAEASGKGKNTQVVSKKNKKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Methylpyridine-2-sulfonyl chloride
OR1045551-01 100 mg

4-Methylpyridine-2-sulfonyl chloride

Sign In for Pricing
View Details
4-Methylpyridine-2-sulfonyl chloride
OR1045551-02 250 mg

4-Methylpyridine-2-sulfonyl chloride

Sign In for Pricing
View Details
4-Methylpyridine-2-sulfonyl chloride
OR1045551-03 1 g

4-Methylpyridine-2-sulfonyl chloride

Sign In for Pricing
View Details
CELSR1 siRNA (m)
sc-60350 10 µM

CELSR1 siRNA (m)

Sign In for Pricing
View Details
Bovine Low density lipoprotein immune complex ELISA Kit
OM617126 96 Strip Well

Bovine Low density lipoprotein immune complex ELISA Kit

Sign In for Pricing
View Details
Human, mouse, rat connexin 32 hemi-channel-scrambled peptide
CX3212-PS-1 1 mg

Human, mouse, rat connexin 32 hemi-channel-scrambled peptide

Sign In for Pricing
View Details