Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (atpB)

This Recombinant ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q8DDH4

Expression Region

1-270

Origin

Vibrio vulnificus

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPGEALTPSGYITHHLTNLSTYKLGLVAEESSFWNVHIDSLFFSWFTGLIFLGIFYAV ARKTTAGVPGKLQCAVEMIVEFVATNVKDTFHGRNPLIAPLALTIFCWVFLMNLMDLVPI DFLPYPAEHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFARELALHPF NHWTMIPFNLLIEVVSLLAKPLSLGMRLFGNMFAGEVVFILCAAMLPWYLQWMGSLPWAI FHILVILIQAFVFMMLTIVYMSMAHEDSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHA Polyclonal Antibody
RA29693-01 50 µL

SDHA Polyclonal Antibody

Sign In for Pricing
View Details
SDHA Polyclonal Antibody
RA29693-02 100 µL

SDHA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Myc-tag Antibody-AF350 labled
BS22262-01 100 µL

Anti-Myc-tag Antibody-AF350 labled

Sign In for Pricing
View Details
Anti-Myc-tag Antibody-AF350 labled
BS22262-02 500 µL

Anti-Myc-tag Antibody-AF350 labled

Sign In for Pricing
View Details
TCF12 Antibody
orb1314603 100 µL

TCF12 Antibody

Sign In for Pricing
View Details
Mouse serine racemase (SRR) ELISA Kit
EIA07742m 1 Kit

Mouse serine racemase (SRR) ELISA Kit

Sign In for Pricing
View Details