Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-14 (Tspan14)

This Recombinant Mouse Tetraspanin-14 (Tspan14) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Tetraspanin-14, Tspan-14, Transmembrane 4 superfamily member 14

UniProt

Q8QZY6

Expression Region

1-270

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHYYRYSNAEVSCWYKYLLFSYNIVFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRLHGID PVVLVLMVGVVMFTLGFAGCVGALRENICLLKFFCGAIVLIFFLELAVAVLAFLFQDWVR DRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKC GVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDEFIFTKGCIQALEGWLPRNIYIVAGVF IAISLLQIFGIFLARTLISDIEAVKAGHHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6985508 1.0 µg DNA

Fbxo2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
D - Leucine
RM1506-5G 1 unit

D - Leucine

Sign In for Pricing
View Details
Mouse mmu-miR-3960 miRNA Antagomir
abx888858-01 10 nmol

Mouse mmu-miR-3960 miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-3960 miRNA Antagomir
abx888858-02 20 nmol

Mouse mmu-miR-3960 miRNA Antagomir

Sign In for Pricing
View Details
Tyrosine 3/Tryptophan 5 Monooxygenase Activation Protein Zeta (YWHAz) Magnetic Luminex Assay Kit
LKU607558 96 Tests

Tyrosine 3/Tryptophan 5 Monooxygenase Activation Protein Zeta (YWHAz) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Human Autophagy-Related Protein 16-1 (ATG16L1) Protein
abx659898-01 10 µg

Human Autophagy-Related Protein 16-1 (ATG16L1) Protein

Sign In for Pricing
View Details