Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-14 (Tspan14)

This Recombinant Mouse Tetraspanin-14 (Tspan14) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Tetraspanin-14, Tspan-14, Transmembrane 4 superfamily member 14

UniProt

Q8QZY6

Expression Region

1-270

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHYYRYSNAEVSCWYKYLLFSYNIVFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRLHGID PVVLVLMVGVVMFTLGFAGCVGALRENICLLKFFCGAIVLIFFLELAVAVLAFLFQDWVR DRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKC GVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDEFIFTKGCIQALEGWLPRNIYIVAGVF IAISLLQIFGIFLARTLISDIEAVKAGHHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-142b miRNA Agomir
orb1917097-01 5 nmol

Mmu-miR-142b miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-142b miRNA Agomir
orb1917097-02 10 nmol

Mmu-miR-142b miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-142b miRNA Agomir
orb1917097-03 20 nmol

Mmu-miR-142b miRNA Agomir

Sign In for Pricing
View Details
NBAS sgRNA CRISPR Lentivector set (Human)
K1393801 3x 1.0 µg

NBAS sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Hsa-miR-376a-3p miRNA Mimic
orb1878582-01 5 nmol

Hsa-miR-376a-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-376a-3p miRNA Mimic
orb1878582-02 10 nmol

Hsa-miR-376a-3p miRNA Mimic

Sign In for Pricing
View Details