Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-17 (Tspan17)

This Recombinant Mouse Tetraspanin-17 (Tspan17) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Tetraspanin-17, Tspan-17, F-box only protein 23, Tetraspan protein SB134, Transmembrane 4 superfamily member 17

UniProt

Q9D7W4

Expression Region

1-270

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGKHQQFQDPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG LDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELAAGILAFVFKDW IRDQLNLFINNNVKAYRDDLDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRE RCGVPFSCCVRDPAEDVLNTQCGYDIRLKLELEQEGSIYTKGCVGQFEKWLQDNLIVVAG VLVGIALLQIFGLCLAQNLVSDIKAVKANW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT5 Antibody
orb683840 100 µL

AGPAT5 Antibody

Sign In for Pricing
View Details
FADD (Fas (TNFRSF6) -Associated via Death Domain, GIG3, MGC8528, MORT1) (HRP)
245926-HRP 100 µL

FADD (Fas (TNFRSF6) -Associated via Death Domain, GIG3, MGC8528, MORT1) (HRP)

Sign In for Pricing
View Details
Canine Interleukin 3 (IL3) ELISA Kit
DL-IL3-c-01 48 Tests

Canine Interleukin 3 (IL3) ELISA Kit

Sign In for Pricing
View Details
Canine Interleukin 3 (IL3) ELISA Kit
DL-IL3-c-02 96 Tests

Canine Interleukin 3 (IL3) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal VLDL R Antibody (6A6) [Biotin]
NBP1-78162B 0.1 mL

Mouse Monoclonal VLDL R Antibody (6A6) [Biotin]

Sign In for Pricing
View Details
Mdm2 ORF Vector (Rat) (pORF)
ORF070407 1.0 µg DNA

Mdm2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details