Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction beta-3 protein (GJB3)

This Recombinant Human Gap junction beta-3 protein (GJB3) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Gap junction beta-3 protein, Connexin-31, Cx31

UniProt

O75712

Expression Region

1-270

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGC TNVCYDNYFPISNIRLWALQLIFVTCPSLLVILHVAYREERERRHRQKHGDQCAKLYDNA GKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIAR PTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCR CHHKLVEAGEVDPDPGNNKLQASAPNLTPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR-3 (BSB-150)
MBS370490-01 5 Slides

FGFR-3 (BSB-150)

Sign In for Pricing
View Details
FGFR-3 (BSB-150)
MBS370490-02 3 mL (RTU)

FGFR-3 (BSB-150)

Sign In for Pricing
View Details
FGFR-3 (BSB-150)
MBS370490-03 0.1 mL (Concentrate)

FGFR-3 (BSB-150)

Sign In for Pricing
View Details
FGFR-3 (BSB-150)
MBS370490-04 7 mL (RTU)

FGFR-3 (BSB-150)

Sign In for Pricing
View Details
FGFR-3 (BSB-150)
MBS370490-05 0.5 mL (Concentrate)

FGFR-3 (BSB-150)

Sign In for Pricing
View Details
FGFR-3 (BSB-150)
MBS370490-06 15 mL (RTU)

FGFR-3 (BSB-150)

Sign In for Pricing
View Details