Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio fischeri ATP synthase subunit a (atpB)

This Recombinant Vibrio fischeri ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B5FCZ7

Expression Region

1-270

Origin

Vibrio fischeri (strain MJ11)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPGEALTQSGYIEHHLTNLSLAKLGLVADEASFWNVHIDSLFFSVFTGMLFLWVFRSV AKKATTGVPGKLQCFVEMIVEFVADNVKETFHGRNPLIAPLALTIFCWVILMNLMDLVPI DFLPYPAEHWLGIPYLKVVPSADVNITMAMALGVFALMIYYSIKVKGLGGFAKELALHPF NHPIMIPFNLLLEVISLLAKPLSLGMRLFGNMFAGEVVFILIAAMLPWYLQWVGALPWAI FHILVILIQAFVFMMLTIVYLSMAHEDSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-500 1x 500 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details