Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Motility protein A (motA)

This Recombinant Bacillus subtilis Motility protein A (motA) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Motility protein A, Chemotaxis protein MotA

UniProt

P28611

Expression Region

1-270

Origin

Bacillus subtilis (strain 168)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKTSLIGIILAFVALSVGMVLKGVSFSALANPAAILIIIAGTISAVVIAFPTKEIKKVP TLFRVLFKENKQLTIEELIPMFSEWAQLARREGLLALEASIEDVDDAFLKNGLSMAVDGQ SAEFIRDIMTEEVEAMEDRHQAGAAIFTQAGTYAPTLGVLGAVIGLIAALSHMDNTDELG HAISAAFVATLLGIFTGYVLWHPFANKLKRKSKQEVKLREVMIEGVLSVLEGQAPKVIEQ KLLMYLPAKDRLKFAEQGEAQNGEKKEEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin beta chain A Polyclonal Conjugated Antibody
C42360 100 µL

Tubulin beta chain A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Olr1078 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV664432 1.0 µg DNA

Olr1078 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
RBP1 Polyclonal Conjugated Antibody
C27262 100 µL

RBP1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Mouse Pulmonary Surfactant Associated Protein A ELISA kit
GTR10432655 96 Well

Mouse Pulmonary Surfactant Associated Protein A ELISA kit

Sign In for Pricing
View Details
Recombinant Mouse TMPRSS2 Protein, N-His
orb3055517-01 50 µg

Recombinant Mouse TMPRSS2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse TMPRSS2 Protein, N-His
orb3055517-02 100 µg

Recombinant Mouse TMPRSS2 Protein, N-His

Sign In for Pricing
View Details